PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.HYM8C
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 395aa    MW: 44491.4 Da    PI: 6.6791
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.HYM8CgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1837.2e-57161431129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdee++++yL++kv ++++++ ++i e+d++k+ePwdLpkk+k +ekewyfF+++d+ky+tg r+nrat+sgyWkatgkdke+++ kg+
  Araip.HYM8C  16 LPPGFRFHPTDEEIITYYLTEKVMNSSFSA-TAIGEADLNKSEPWDLPKKAKMGEKEWYFFCQKDRKYPTGMRTNRATDSGYWKATGKDKEIFKGKGN 112
                  79**************************99.88***************99999********************************************* PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                  lvg+kktLvfy+grapkgekt+Wvmhe+rle
  Araip.HYM8C 113 LVGMKKTLVFYRGRAPKGEKTNWVMHEFRLE 143
                  ****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.05E-6213168IPR003441NAC domain
PROSITE profilePS5100559.02716167IPR003441NAC domain
PfamPF023653.1E-2917142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:1900057Biological Processpositive regulation of leaf senescence
GO:1903648Biological Processpositive regulation of chlorophyll catabolic process
GO:0000975Molecular Functionregulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MEEPVVVNKG EEPLDLPPGF RFHPTDEEII TYYLTEKVMN SSFSATAIGE ADLNKSEPWD  60
LPKKAKMGEK EWYFFCQKDR KYPTGMRTNR ATDSGYWKAT GKDKEIFKGK GNLVGMKKTL  120
VFYRGRAPKG EKTNWVMHEF RLEGKFANYN LPKAAKDEWV VSRVFHKNTD VKKTTTPSSS  180
SSIIPGLLRI NSIGDDLLDC STLPPLMDPH PTPLDTTKSD GYYFPSFSSS HQILNIKPEE  240
HNTSHQIPIT NYQIPNFNTT LSSSSSHQIR LQNHLNLFSS SSSNNNYHNS SWPTYYDEVH  300
HHHQDDILLR AIASKNYSNG GGGAGECKVE QFSSGNQSVV SVSQETGLSN DRTTNDTSSV  360
VSKQQHNNRT LYEDLEGPSS SVAPLSDLEC LWDTY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-531417315171NO APICAL MERISTEM PROTEIN
1ut4_B5e-531417315171NO APICAL MERISTEM PROTEIN
1ut7_A5e-531417315171NO APICAL MERISTEM PROTEIN
1ut7_B5e-531417315171NO APICAL MERISTEM PROTEIN
3swm_A7e-531417318174NAC domain-containing protein 19
3swm_B7e-531417318174NAC domain-containing protein 19
3swm_C7e-531417318174NAC domain-containing protein 19
3swm_D7e-531417318174NAC domain-containing protein 19
3swp_A7e-531417318174NAC domain-containing protein 19
3swp_B7e-531417318174NAC domain-containing protein 19
3swp_C7e-531417318174NAC domain-containing protein 19
3swp_D7e-531417318174NAC domain-containing protein 19
4dul_A5e-531417315171NAC domain-containing protein 19
4dul_B5e-531417315171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00332DAPTransfer from AT3G04060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016162135.10.0PREDICTED: NAC domain-containing protein 100-like
TrEMBLA0A0L9U6Y81e-179A0A0L9U6Y8_PHAAN; Uncharacterized protein
TrEMBLA0A0S3RWF81e-179A0A0S3RWF8_PHAAN; Uncharacterized protein
STRINGGLYMA19G28515.11e-178(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.11e-108Arabidopsis NAC domain containing protein 87